SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000231 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000231
Domain Number 1 Region: 19-146
Classification Level Classification E-value
Superfamily Lysozyme-like 1.34e-52
Family C-type lysozyme 0.00000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000231   Gene: ENSBTAG00000000198   Transcript: ENSBTAT00000000231
Sequence length 147
Comment pep:known chromosome:UMD3.1:5:44443587:44448198:1 gene:ENSBTAG00000000198 transcript:ENSBTAT00000000231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALLILGLLLLSVAVQGKTFKRCELAKTLKNLGLAGYKGVSLANWMCLAEGESSYNTQA
KNYNPGSKSTDYGIFQINSKWWCNDGKTPKAVNGCGVSCSALLKDDITQAVACAKKIVSQ
QGITAWVAWTNKCRNRDLTSYVKGCGV
Download sequence
Identical sequences G5E502
ENSBTAP00000000231 ENSBTAP00000000231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]