SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000359 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000359
Domain Number 1 Region: 339-746
Classification Level Classification E-value
Superfamily Phosphofructokinase 2.75e-108
Family Phosphofructokinase 0.00000837
Further Details:      
 
Domain Number 2 Region: 15-337
Classification Level Classification E-value
Superfamily Phosphofructokinase 2.75e-106
Family Phosphofructokinase 0.000000274
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000359   Gene: ENSBTAG00000000286   Transcript: ENSBTAT00000000359
Sequence length 779
Comment pep:known chromosome:UMD3.1:5:32312957:32337525:-1 gene:ENSBTAG00000000286 transcript:ENSBTAT00000000359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGARVFFVHEGYQGLVDG
GDNIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDGS
LTGADTFRSEWSDLLSDLQKSGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSA
LHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEE
HLCRRLSETRNRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQR
GGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTRA
MDERRFDEALKLRGRSFMNNWEVYKLLAHVRPPKSKSGSHTVAVMNVGAPAAGMNAAVRS
TVRIGLIQGNRMLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQI
SANITKFNIQGLVIIGGFEAYTGGLELMEGRKQYDELCIPFVVIPATVSNNVPGSDFSVG
ADTALNTICMTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEDPFT
IRDLQVNVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGH
MQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANSPDSGCVLGMRKRALVFQ
PVTELKEQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSEHAHLEHISRKRSGEANV
Download sequence
Identical sequences Q0IIG5
ENSBTAP00000000359 ENSBTAP00000000359 NP_001068736.1.59421 NP_001068736.1.76553 XP_005905529.1.15283 XP_005905530.1.15283 XP_005905531.1.15283 XP_010835801.1.44457 XP_010835803.1.44457 XP_010835804.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]