SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000488 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000488
Domain Number 1 Region: 373-643
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-79
Family Protein kinases, catalytic subunit 0.0000000162
Further Details:      
 
Domain Number 2 Region: 5-145
Classification Level Classification E-value
Superfamily PH domain-like 2.16e-43
Family Pleckstrin-homology domain (PH domain) 0.0000501
Further Details:      
 
Domain Number 3 Region: 270-416
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-33
Family SH2 domain 0.000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000488   Gene: ENSBTAG00000000377   Transcript: ENSBTAT00000000488
Sequence length 654
Comment pep:known_by_projection chromosome:UMD3.1:X:135201710:135238777:-1 gene:ENSBTAG00000000377 transcript:ENSBTAT00000000488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKI
RCVEKVNLEEQTPVERQYPFQIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLIKY
HSGFFVDGKFLCCQQSCKAAPGCTLWEAYADLHTAPKEEKHGVPIFPDRVLKIPRAVPIL
KVDEPSSSTTLAQYDSDSKKNYGSQSNINMKYISKEDFPDWWQVRKLHSASSSEDLACSN
QRERNVVNHNTSKMSWGSPESSSSEEEENLDDYDWFAGNISRSQSEQLLRQKGKEGAFMV
RNSSQAGMYTVSLFSKAMNDKKGTVKHYHVHTNAENKLYLAENYCFDSIPKLIHYHQHNS
AGMITRLRHPVSTKANKVPISVSLGSGIWELKREEITLLKELGSGQFGVVHLGKWKGKYD
VAVKMIKEGSMSEDEFFQEAQTMTKLNHPKLVKFYGVCSKRYPIYIVTEYITNGCLLSYL
KSHGKRLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDSDLSVKVSDFGMTRYV
LDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQV
VVKVSQGHRLYRPQLASDTVYHIMYSCWHELPEKRPTFQQLLSSIEPLREKDKP
Download sequence
Identical sequences G3X680
ENSBTAP00000000488 ENSBTAP00000000488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]