SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000589 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000589
Domain Number 1 Region: 3-91
Classification Level Classification E-value
Superfamily EF-hand 1.37e-22
Family S100 proteins 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000589   Gene: ENSBTAG00000037651   Transcript: ENSBTAT00000000589
Sequence length 97
Comment pep:known chromosome:UMD3.1:3:16869280:16872613:1 gene:ENSBTAG00000037651 transcript:ENSBTAT00000000589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPLEQALAVMVATFHKYSGQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMG
DLDENSDQQVDFQEYAVFLALITIMCNDFFQGSPARS
Download sequence
Identical sequences P10462
ENSBTAP00000000589 NP_001029539.1.59421 NP_001029539.1.76553 XP_004002577.1.66739 XP_005677557.1.57651 XP_005910071.1.15283 XP_005975047.1.78601 XP_005975048.1.78601 XP_006041114.1.26621 XP_006041115.1.26621 XP_010836723.1.44457 XP_010836724.1.44457 XP_010836726.1.44457 XP_011987541.1.54773 XP_014338538.1.15283 XP_019810877.1.53367 ENSBTAP00000000589 9913.ENSBTAP00000000589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]