SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000843 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000843
Domain Number 1 Region: 8-114
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-37
Family Pleckstrin-homology domain (PH domain) 0.00000459
Further Details:      
 
Domain Number 2 Region: 199-263
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000105
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000843   Gene: ENSBTAG00000000641   Transcript: ENSBTAT00000000843
Sequence length 270
Comment pep:known_by_projection chromosome:UMD3.1:19:38697518:39001101:1 gene:ENSBTAG00000000641 transcript:ENSBTAT00000000843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDIERGAQELDNIIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGI
FLIKGYSVRMAPYLRKDYKKEYCFELTSQDRRSYEFTASSPAEARDWVNQISFLLKDLSS
LTIPYEEEEEEEEEEEKEEEEEMYDDIDGFDSSNSGSQSRPIVLPGSVGLKEAMEEKEDD
IYEILPEEEHDLEEDESGTQQKGVDYASYYQGLWDCHGDQSDELSFQRGDLIRILSKEYS
MYGWWVGELNSLIGIVPKEYLTTAFEVEER
Download sequence
Identical sequences E1B8S2
ENSBTAP00000000843 ENSBTAP00000000843 9913.ENSBTAP00000000843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]