SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000847 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000847
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily EF-hand 6.42e-21
Family S100 proteins 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000847   Gene: ENSBTAG00000000644   Transcript: ENSBTAT00000000847
Sequence length 93
Comment pep:known_by_projection chromosome:UMD3.1:3:16891318:16894701:1 gene:ENSBTAG00000000644 transcript:ENSBTAT00000000847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEKMRESSIDDLMKSL
DKNSDQEIDFKEYSVFLTTLCMAYNDFFLEENQ
Download sequence
Identical sequences E1B8S0
NP_001179144.1.59421 NP_001179144.1.76553 XP_005203742.1.76553 XP_005203743.1.76553 XP_005203744.1.76553 XP_005910067.1.15283 XP_014338542.1.15283 XP_019813907.1.53367 ENSBTAP00000000847 9913.ENSBTAP00000000847 ENSBTAP00000000847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]