SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000935 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000935
Domain Number 1 Region: 9-214,260-341
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-47
Family Calponin-homology domain, CH-domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000935   Gene: ENSBTAG00000000700   Transcript: ENSBTAT00000000935
Sequence length 347
Comment pep:known chromosome:UMD3.1:15:40748739:40902329:-1 gene:ENSBTAG00000000700 transcript:ENSBTAT00000000935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLP
LSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLA
EDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVD
TVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEA
LSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLM
GLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPE
Download sequence
Identical sequences F6QTA8
ENSBTAP00000000935 ENSBTAP00000000935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]