SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001177 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001177
Domain Number 1 Region: 214-473
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.07e-50
Family Glycerophosphoryl diester phosphodiesterase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001177   Gene: ENSBTAG00000000886   Transcript: ENSBTAT00000001177
Sequence length 509
Comment pep:known chromosome:UMD3.1:15:57434891:57523813:-1 gene:ENSBTAG00000000886 transcript:ENSBTAT00000001177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQRERIFYPWLIMSFFLSTILLFTWVETSNEYNGFDWVVFLGARIWFFWSLVLLSVIGIL
AAYTTMLVVLGFLLCWEKNELYLHWYHKIMVLIVILLCSFLMWILLTFWRERWLTIGLSL
QVFAPYIHLSSISAMVLLSWPVAFYLIHLEGEARMRRYQNTSERRRNKWCTMLTKLRVLQ
VVVGLPFLLILLCLYVVPFGTYSPCVQEKDKLAPKPDFFGHRGAPMLGPENTIMSFEKAV
EQGAHGLESDVQISLDEVPFLMHDYDLRRTTNILEVMPNASDEQSNFFYWDFLSTLNAGK
WFADSWIKPFFGMKPLSEADRERARNQKIPKLSELLEIARKAKKKVIFDLYTPPRSHPSR
SSYIRLVVSVILDSKIEQHLIIWLPGSERDYVRSKAPGFQHIGRLFTIERLTKEKITRIN
VDYKNLFYNGLKEYKAANITINVYLVNEPWLFSLAWCSSIHSVTTDNIQVLKEINHPYYF
MTPDFYMFMWIFLDILSAVFIVAIFYSIW
Download sequence
Identical sequences F1MTT5
ENSBTAP00000001177 ENSBTAP00000001177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]