SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001190 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001190
Domain Number 1 Region: 856-983,1015-1220
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.84e-77
Family p120GAP domain-like 0.0003
Further Details:      
 
Domain Number 2 Region: 6-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-37
Family Calponin-homology domain, CH-domain 0.0000222
Further Details:      
 
Domain Number 3 Region: 1450-1548
Classification Level Classification E-value
Superfamily RGC domain-like 1.23e-33
Family RGC domain 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001190   Gene: ENSBTAG00000000897   Transcript: ENSBTAT00000001190
Sequence length 1548
Comment pep:known_by_projection chromosome:UMD3.1:10:7554265:7867328:1 gene:ENSBTAG00000000897 transcript:ENSBTAT00000001190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDERRRQNIAYEYLCHLEEAKRWMEVCLVEELPPTTELEEGLRNGVYLAKLAKFFAPKMV
SEKKIYDVEQTRYKKSGLHFRHTDNTVQWLRAMESIGLPKIFYPETTDVYDRKNIPRMIY
CIHALSLYLFKLGIAPQIQDLLGKVDFTEEEISNMRKELEKYGIQMPSFSKIGGILANEL
SVDEAALHAAVIAINEAIEKGIAEQTIVTLRNPNAVLTLVDDDLAQEYQKELWEAKKRKE
ENARLKSNCISEEERDAYEELLTQAEIQGNINKVNRLAAVDHINAVIREGDPENTLLALQ
RPEAQLPVVYPFAAAMYQNELFNLQKQNAMNYLAHEELLIAVEMLSAVALLNQALESSDL
VSVQNQLRSPTIGFNNLDETYVERYANALLAIKLEALSQEQDTLSWNEIQNCIDMVNIEI
QEENDRVVAVGYINEAIDEGDPLRTLDSLLLPTAKIKDVDPDFARHYQDVLYQAKTQKYM
DPQSASKILWLDEIQHAVNEANKDINKAKQWVTLVVDVNQFLEKEKQSDILSVLKPAVGN
ANDVIPECADRYHDALAKAKEQKSRSVSTEGSWLKLTLQEKYDYYYNIDSKESSWVTPEP
CLLKESWLMGKEIEDIVEDITADYIREKIWSASKDMLQRFQATTSGPLIRKEYEARKAFL
YEQEKHVVKIQAFWKAYKQREAYKRRRQMFIDNIRFIVKIQSWYRMVTARRNYLSRLQFF
RAHNNEIVKIQSLLRASKARDDYKTLVGSENPPLRVIRKFVYLLDQSDLDFQEELEVARL
REEVVTKIRGNQQLEKDLNLMDIKIGLLVKNRITLEDVISHRTKLNKKKGGEMEILNNID
NQGIKSLSKERRKTLETYQQLFYLLQTNPSYLAKLIFQMPQNKSTKFMDTVIFTLYNYAS
NQREEYLLLKLFKTALEEEIASKVDQVQDIVTGNPTVIKMVVSFNRGARGQNMLRQLLAP
VVKEIIDDKSLIINTSPVEVYKAWVNQLETQTGEASNLPYDVTTEQALTYPEVRTKLEAS
IEHLRRVTDQVLNSIISSLDLLPYGLRYIAKVLKNSIHEKFPDATEDELLKIVGNLLYYR
YMNPAIVAPDGFDIIDMTAGGQINSDQRRNLGSVAKVLQHAASNKLFEGENEHLSSMNSY
LSETYQEFRKYFKEACNVPEPEEKFNMDKYTDVVTVSKPVIYISIEEIINTHSLLLEHQD
AIAPEKNDLLNELLELLEEVPNVESFLGEGAVDPNDPDKVNTLNQLSKTEISLYLTSKYD
IGDGEAIDGQSLMIKTKKLIIDVIRNQPGSTLTEILETPASAKQETDHASDMVNRAVLDS
RTPEDMKQSRSMVEDAQLPLEQKKRKIQRNLRTLEQTGHVSSKNKYQDILNKIAKDIRNQ
RIHRKLRKAELEKLQQTLNALNKKAAFFEEQINYYDTYIKTCLDNLKRKNTRRSIKLDGK
GEPRGMKRAKPVRYTAAKLQEKGVLLDIDDLQANQFKNVTFDISSTEDVGIFDVRSKFLG
VEMEKVQLNIQDLLQMQYEGVAVMKMFDKVKVNVNLLIYLLNKKFYGK
Download sequence
Identical sequences F1MTR1
ENSBTAP00000001190 ENSBTAP00000001190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]