SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001250 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001250
Domain Number 1 Region: 292-448
Classification Level Classification E-value
Superfamily EF-hand 7.49e-17
Family Calmodulin-like 0.011
Further Details:      
 
Domain Number 2 Region: 52-272
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.00000000000405
Family Glycerol-3-phosphate (1)-acyltransferase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001250   Gene: ENSBTAG00000000944   Transcript: ENSBTAT00000001250
Sequence length 489
Comment pep:known chromosome:UMD3.1:20:71141671:71165741:1 gene:ENSBTAG00000000944 transcript:ENSBTAT00000001250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAVMTLTLFPVRLLVVVLMMLLAWPLALVSSLGPAGREPEQPPALWRRVVDVLLRAIMRT
MWLAGGFHHVAVKGRRAPPTEAAILTLAPHSSYFDAVVPPNVPISSWSFLVASGIIREEG
ALIKYIRPVFVSRTDQDSRRKTVEEIKRRAQSGGKWPQIMIFPEGTCTNRTCLITFKPGA
FIPGVPVQPVVLRYPNKLDTITWTWQGPGALKILWLTLCQFHSQVEIEFLPVYTPSEEEK
RDPALYASNVRRVMAEALGVAVTDYTFEDCQLALAEGQLRLPADTCLLEFARLLRGLGLK
PEKLEQDLDRHAESARMTQGRRVTLPEFAAQLGVPESESLEDLFSLFDEGGGGEVDLREY
VVALSVVCRPARTLDTIQLAFKMFGSQDGSVEEHALSSILKTALGVAELTVTDLFRAIDQ
ERKGRIAFADFKRFAEANPDFAEEYLYPEQTRPRSCARTPPAPTPNGFCADFSPENSATG
TEPVRKKLD
Download sequence
Identical sequences F1MTK4
ENSBTAP00000001250 ENSBTAP00000001250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]