SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001271 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001271
Domain Number 1 Region: 17-149
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-31
Family Pleckstrin-homology domain (PH domain) 0.000000598
Further Details:      
 
Domain Number 2 Region: 171-266
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000249
Family SH2 domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001271   Gene: ENSBTAG00000000962   Transcript: ENSBTAT00000001271
Sequence length 288
Comment pep:known chromosome:UMD3.1:6:85013014:85043206:1 gene:ENSBTAG00000000962 transcript:ENSBTAT00000001271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAKKPPKPAPRRIFQERSKITALPLYFEGFLSVKRSEYQEYKHYWTELRGTTLFFYTDK
KSTTYVDKLDIIDLTCLTDQNSTEKNCVKFTLVLPKEDVQLKIENTESGEEWKGFILTVT
ELSVPLHVSLLPGQVIRLHEVLEKEKKRRIETERTPSSSPEKGKQPVEDYEDVLNPMPAC
FYSVSRKEATEMLEKNPSMGNMILRPGSDSRNYSITIRQEIDLPRIKHYKVMSAGKNYTI
DLEKPVTLPNLFSVIDYFVKETRGNLRPFIYSTDETLETKGFPVTSLK
Download sequence
Identical sequences A0JNF9
ENSBTAP00000001271 9913.ENSBTAP00000001271 NP_001071336.1.59421 NP_001071336.1.76553 ENSBTAP00000001271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]