SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001426 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001426
Domain Number 1 Region: 6-180
Classification Level Classification E-value
Superfamily EF-hand 6.24e-28
Family Calmodulin-like 0.011
Further Details:      
 
Domain Number 2 Region: 161-228
Classification Level Classification E-value
Superfamily EF-hand 0.000000000522
Family Polcalcin 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001426   Gene: ENSBTAG00000001075   Transcript: ENSBTAT00000001426
Sequence length 271
Comment pep:known chromosome:UMD3.1:18:39808727:39838373:-1 gene:ENSBTAG00000001075 transcript:ENSBTAT00000001426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPQQQPPYLHLAELTATQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMVSK
SDNLGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSTEFMEAWRKYD
TDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLL
PVQENFLLKFQGMKLTSEEFNAIFTFYDKDGSGYIDENELDALLKDLYEKNKKEMNIQQL
TSYRKSVMSLAEAGKLYRKDLEIVLCSEPPL
Download sequence
Identical sequences F1MJW8 L8IEW0 W5P1A7
9913.ENSBTAP00000001426 ENSOARP00000004206 ENSBTAP00000001426 XP_004015175.1.66739 XP_005692287.1.57651 XP_005899596.1.15283 XP_005958335.1.78601 XP_006060479.1.26621 XP_010849198.1.44457 XP_011966150.1.54773 XP_019834254.1.53367 XP_020764242.1.74333 ENSBTAP00000001426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]