SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001431 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001431
Domain Number 1 Region: 16-146
Classification Level Classification E-value
Superfamily PH domain-like 3.14e-27
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 
Domain Number 2 Region: 272-390
Classification Level Classification E-value
Superfamily SH2 domain 3.87e-16
Family SH2 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001431   Gene: ENSBTAG00000001082   Transcript: ENSBTAT00000001431
Sequence length 428
Comment pep:known_by_projection chromosome:UMD3.1:2:132522953:132529468:1 gene:ENSBTAG00000001082 transcript:ENSBTAT00000001431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKAGAGGRRASDCGPAPQRPRCITKFAQYVGSFPVDDLDPQESVWLVQQQLWALKDCPR
RRAVILKFSLQGLKIYSGEGEVLLMAHALRRILYATWCPADCQFAFMARNPRSPASKLFC
HLFVGSQPGEVQILHLLLCRSFQLAYLLQHPEERARPEPCPEPVGDAPLKPVPGPGGPPG
LVREPFGRDQLSQNVNALVSFRRLPAEGSGGSGKELLESASRGGTRHLRLGNPYCSPTLV
RKKAIRSKVLRSGAYRACTYETQLQLSAREALPAAWEAWPRGPGGPSCLVESEGSLTENI
WAFAGISRTSALALLRRDVLGAFLLWPEPGANGQWCLSVRTQCGVVPHQVFRNHVGRYCV
EHLPAEFPSLEALVEHHAGTERSLFCSLDMGRLNPGYEEQDCGPSGQPPRTLRPLGHAKS
EAELQGLG
Download sequence
Identical sequences E1BA40
NP_001178184.1.59421 NP_001178184.1.76553 XP_010800924.1.76553 ENSBTAP00000001431 ENSBTAP00000001431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]