SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001572 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001572
Domain Number 1 Region: 319-437
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-23
Family SH2 domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001572   Gene: ENSBTAG00000001186   Transcript: ENSBTAT00000001572
Sequence length 450
Comment pep:known_by_projection chromosome:UMD3.1:27:38028400:38084141:-1 gene:ENSBTAG00000001186 transcript:ENSBTAT00000001572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKQILSEMYIDPDLLAELNEEQKQILFFKMREEQVRRWKEREASMEKQESLPVKPRPKK
DNGRSVHWKLGADNEVWVWVMGEHHLDKPYDVICDEILAERARLKAEQETPELRKAQPGE
LSSSSKSKLPSSEGRAPGAGETGNVGDKVAEAGTPGRGCGPAAPLAEQKAPLSSSSSRNI
HQMLADSVSRIKEFGFHQKKVSVKKTQDEEIKQIDEERTKEIYKNWKEDSEWQASLRKSK
AADEKRRSLAKQAREDYKRLSQRGRSGKGQQGPPGGPQKPKRPPLPPKPHFLSPAGQPHT
PLRNQRVRRPASSPAQEDIRRWFQEEQLPLRAGYLADSDSIAPWFHGILTVNRANELLST
CVPGSFLIRVNEKVKGYTLSYQSEDGCKHFLIDASSDSYSFLGVDQLQHASLAELVEYHK
EEPITSLGKELLLYPCGQQREPPDYLELFE
Download sequence
Identical sequences E1BBL1
ENSBTAP00000001572 ENSBTAP00000001572 9913.ENSBTAP00000001572 XP_005197272.1.59421 XP_005226216.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]