SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001698 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001698
Domain Number 1 Region: 1-310,414-454
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.86e-76
Family FAD-linked reductases, N-terminal domain 0.0000000000963
Further Details:      
 
Domain Number 2 Region: 290-400
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.21e-34
Family L-aminoacid/polyamine oxidase 0.00000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001698   Gene: ENSBTAG00000001288   Transcript: ENSBTAT00000001698
Sequence length 520
Comment pep:known chromosome:UMD3.1:X:105235855:105359152:1 gene:ENSBTAG00000001288 transcript:ENSBTAT00000001698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKCDVVVVGGGISGMAAAKLLHDSGLNVIVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNHILRLSKELGLETYKVNEVERLIHHTKGKSYPFRGSFPSVWNPITYLDHNNLWR
TMDDMGREIPSDAPWKAPLAEQWDLMTMKELLDKICWTESSKQLAILFVNLCVTAEIHEV
SALWFLWYVKQCGGTTRIFSTSNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIHIDQ
TGENVLVETLNHELYEAKYVISAVPPVLGMKIHFNPPLPMMRNQLITRVPLGSVIKSIVY
YKEPFWRNMDYCGSMIIEGEEAPVAYALDDTKPDGSYPAIIGFILAHKARKLARLTKEER
LKKLCDLYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTSYFPPGIMTQYGRVLRQPVGR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWLPEPESVDVPAKPITTT
FLQRHLPSVPGLLKLIGLTTIFSATALGYLAHKRGLLVRI
Download sequence
Identical sequences A0A140T837
NP_808813.2.59421 NP_808813.2.76553 XP_019811700.1.53367 ENSBTAP00000001698 ENSBTAP00000001698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]