SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001995 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001995
Domain Number 1 Region: 264-533
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.22e-81
Family Protein kinases, catalytic subunit 0.000000000324
Further Details:      
 
Domain Number 2 Region: 151-295
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-40
Family SH2 domain 0.00000613
Further Details:      
 
Domain Number 3 Region: 80-202
Classification Level Classification E-value
Superfamily SH3-domain 1.1e-26
Family SH3-domain 0.0000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001995   Gene: ENSBTAG00000001523   Transcript: ENSBTAT00000001995
Sequence length 541
Comment pep:known chromosome:UMD3.1:24:35973659:36038238:-1 gene:ENSBTAG00000001523 transcript:ENSBTAT00000001995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSKENKSPSIKYRPENTPEPVSTGVGHYGGEHAVVAPTSSTKSTSANFSSLSMTPF
GGSSAVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIIN
NTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIF
LVRESETTKGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTE
HADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKV
AIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKE
GDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIE
DNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVL
EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGEN
L
Download sequence
Identical sequences A7MB57 L8IGA3
NP_001094530.1.59421 NP_001094530.1.76553 XP_005898956.1.15283 XP_010827199.1.44457 XP_015315572.1.76553 XP_019842376.1.53367 ENSBTAP00000001995 9913.ENSBTAP00000001995 ENSBTAP00000001995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]