SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002106 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000002106
Domain Number - Region: 118-184
Classification Level Classification E-value
Superfamily EF-hand 0.00174
Family EF-hand modules in multidomain proteins 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002106   Gene: ENSBTAG00000001600   Transcript: ENSBTAT00000002106
Sequence length 203
Comment pep:known chromosome:UMD3.1:6:69355762:69434440:1 gene:ENSBTAG00000001600 transcript:ENSBTAT00000002106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFIQEQQATHPQGSEGMRHWTDFQLNSHLSTLANIHKIYHTLNKLNLTEDVGQDDHQTG
SLRSCSSSDCFSKVMPPRKKRRPASGDDLSAKKSRHDSMYRKYDSTRIKTEEEAFSSKRC
LEWFYEYAGTDDVVGPEGMEKFCEDIGVEPENVVMLVLAWKLDAQNMGYFTLQEWLKGMT
SLQQKMVLVIASCWLAPWQSRSE
Download sequence
Identical sequences Q32KS5
ENSBTAP00000002106 ENSBTAP00000002106 9913.ENSBTAP00000002106 NP_001069568.1.59421 NP_001069568.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]