SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002128 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002128
Domain Number 1 Region: 408-526
Classification Level Classification E-value
Superfamily EF-hand 4.64e-16
Family Calmodulin-like 0.019
Further Details:      
 
Domain Number 2 Region: 142-234
Classification Level Classification E-value
Superfamily EF-hand 0.00000273
Family Calmodulin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002128   Gene: ENSBTAG00000001621   Transcript: ENSBTAT00000002128
Sequence length 531
Comment pep:known_by_projection chromosome:UMD3.1:19:47043850:47097593:1 gene:ENSBTAG00000001621 transcript:ENSBTAT00000002128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKGHLFCQGEENTDSSDDDCNSVAADLLSRDIDSKKYIKFSKTTEKRISPEIRGLSPE
HTKKYETSIFLLGEEKSSSFSGEKKGRRKKSLQVQLHTKRTEVKPVFLIIMKEKMTRKES
SLCKLPSQCSIHKTLSPLDRSSSVIRYDVFINRLWDLRFFDCLKIFLYILYFAAFQNALK
IFHRIKCGRVPVSEVDKVLDSMDILVVPETLQEVIKYADINSNQMVDIGDIIFTLDELQQ
EYENISIMEGTALDEATSRKLSNVSGCYPQYRKKSILSSGLSESSLFQKSNTKSLQNHKI
MSENDDYEFKRPKNILQIRKFQDEIDSSDIEFQEPYSKDGMNFKKSSEKVEIHDSKSKPQ
DLKHVSGLKKSLDKSDIFSIPKLQKPAVRRSSSLLKQVSSKEKTAINALGNVCETIKKLQ
ENYIDAEELQSILPSIGITLSDKEFKKIVTDTARNENGMVKLDDFVSAVSKEQNLPEYDV
LTDVVKAIDKIKDENIDYGDLNTCLQNLGVYLSKPEFQKITELTEVGGKKK
Download sequence
Identical sequences F1N5T8
ENSBTAP00000002128 ENSBTAP00000002128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]