SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002157 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002157
Domain Number 1 Region: 1049-1318
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.06e-42
Family Extended AAA-ATPase domain 0.011
Further Details:      
 
Domain Number 2 Region: 1739-1992
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.43e-39
Family Extended AAA-ATPase domain 0.09
Further Details:      
 
Domain Number 3 Region: 659-720,816-979
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.75e-34
Family Extended AAA-ATPase domain 0.077
Further Details:      
 
Domain Number 4 Region: 1363-1641
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.31e-33
Family Shikimate kinase (AroK) 0.072
Further Details:      
 
Domain Number 5 Region: 297-513,541-587
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.73e-29
Family Extended AAA-ATPase domain 0.016
Further Details:      
 
Domain Number 6 Region: 2051-2314
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.02e-19
Family Extended AAA-ATPase domain 0.049
Further Details:      
 
Domain Number 7 Region: 5383-5586
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000779
Family Integrin A (or I) domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002157   Gene: ENSBTAG00000001644   Transcript: ENSBTAT00000002157
Sequence length 5596
Comment pep:known_by_projection chromosome:UMD3.1:9:61291441:61430150:1 gene:ENSBTAG00000001644 transcript:ENSBTAT00000002157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHLLLDVAAAPLRLIAAKNEKSRSELGRFLVKQVWTPQDRQCILTTLAQLLLDKDCTVL
ISRQLRPLLLDLLERNAEAIKAGGQVNHDLHERLCVSMSKLIGNHPDVLPFALRYFKDTS
PVFQRLFLESSDANPVRYGRRRMKLRDLMEAAYKFLQQEQSVFRDLWDWSVCVPLLRSHD
TLVRWYTANCLALVTCMNEEHKLSFLKKIFNSEELIHFRLRLLEEAQLQDLEKALVLANP
DTPLWRKDKELQYSTGHLVSADLSSRVTAVCGVVLPGQLPAPEERGSSRSSSREQELTFR
SYVLVDSVCKNLQTLAMAVASQNAVLLEGPIGCGKTSLVEHLAAMTGRRKPSQLLKVQLG
DQTDSKMLLGMYRCTDVPGEFVWQPGTLTQAATKGHWILLEDIDYAPLDVVSVLIPLLEN
GELLIPGRGDCVKVAPGFQFFATRRLLSCGGNWYRPLNSHATLLDKYWTKIHLDNMDKAE
LNEVLQNRYPSLSAATDHLLDIYFQLIGEKHHCLSESSVGGEQAPGEVPEARQENKRLSL
EGRELSLRDLLNWCNRIAHSFDSLSSSASLNIFQEALDCFTAMLSKQTSKLKMAEVIGSK
LNISKKKVEFFCQLYKPEIVINELDVQVGRVRLLRKQSEAVHIQREKFTFAATRPSSVLI
EQLAVCVSKGEPVLLVGETGTGKTSTVQYLAHITGHRLRVVNMNQQSDTADLLGGYKPVD
HKLIWLPLREAFEELFVQTFSKKQNFTFLGHIQTCYRQKRWQDLLKLMQHVHKSAVNKAG
AESEPGSLLKEKWEAFGLRLNHAQQQMKMTENALLFAFVEGTLAQAVKRGEWILLDEINL
AAPETLECLSGLLEGSSGSLVLLDRGDTAEPLVRHPDFRLFACMNPATDVGKRNLPPGIR
NRFTELYVEELESKEDLQILIVDYLKGLSVNKNTVQGIITFYTAVRKESGTKLVDGTGHR
PHYSLRTLCRALQFAASNPCGNIQRSLYEGFCLGFLTQLDRASHPVVQKLICQHIVSGNI
KSLLKQPIPEPKGGRLIQVEGYWISVGDKEPTIDETYILTSSVKLNLRDIVRVVSAGTYP
VLIQGETSVGKTSLIRWLAAATGNHCVRINNHEHTDIQEYIGCYTSDSSGKLVFKEGVLI
DAMRKGYWIILDELNLAPTDVLEALNRLLDDNRELLITETQEVVKAHPRFMLFATQNPPG
LYGGRKVLSRAFRNRFVELHFDELPSSELETVLHKRCSLPPSYCSKLVKVMLDLQSYRRG
SSVFAGKQGFITLRDLFRWAERYRLAEQTEKEYDWLQHLANDGFMLLAGRVRKQEEVVVI
QEVLEKHFKKKLCPQSLFSKENVLKLLSKLSTPMSTLESKFSHIVWTEGMRRLAMLVGRA
LQFSEPVLLVGDTGCGKTTICQVFAALANQKLYSVNCHLHMETSDFLGGLRPVRQKPNDK
EEIDTSRLFEWHDGPLVLAMKEDGFFLLDEISLADDSVLERLNSVLEVEKTLLLAEKGNL
EDKDNEVELLTAGKKFRILATMNPGGDFGKKELSPALRNRFTEIWCPQSTKREDLIQIIS
RNLHPGLSLGRTDHKGADIAEVMLDFIDWLTHQEFGRRCVVSIRDILSWVNFMNTMGEEA
ALKRQETISTVTSFVHAACLVYIDGIGSGVTSSGFGTALLARRECLKFLIKKLSKIGRLT
ESQKNELKIYDRLKDKEFTGIDNLWGIHPFFIPRGPVLHRNNIADYALSAGTTAMNAQRL
LRATKLNKPILLEGSPGVGKTSLVGALARASGNTLVRINLSEQTDITDLFGADLPVEGGK
GGEFAWRDGPLLAALKAGHWVVLDELNLASQSVLEGLNACFDHRGEIYVPELGMSFQVQH
EKTKIFGCQNPFRQGGGRKGLPRSFLNRFTQVFVDPLTVIDMEFIASTLFPAIDKNIVKK
MVAFNNQIDHEVTVEKKWGQIGGPWEFNLRDLFRWCQLMLVDQSPGCYDPGQHVFLVYGE
RMRTKEDKEKVIAVFKDVFNSNSNPYMGTRLLHITPYDVQLGYSVLSRGSYVPPPTCRPL
SLLHQSLQSLESVMKCVQMSWMVILVGPASVGKTSLVQLLAHLTGHTLKIMAVNSAMDTT
ELLGGFEQVDLIRPWRQLLEKVEGTVRALVRDSLLVSADDAEVVLRAWSHFLLTYKPRCL
GEGGKCVTMEIVNKLEAVLLLMQRLNNKINSYSKAEFAKFVEEFRSFGVKLMQSASGHSR
GTFEWVDSMLVQALKSGDWLLMDNVNFCNPSVLDRLNALLEPGGVLTVSERGMIDGSTPT
VTPHPNFRLFLSMDPVHGEISRAMRNRGLEIYISGDGDGSIPDDLDLKVLLHSLGLVGDS
VCDTLLALHSETRSAVVASPASSVSNLIQTASLIVQYLQRGLSLDSAFSKACWEAYVRSQ
ASPANQQLVQALLEKHVSSLQAHETWGSSLLALGLWPDSLPSAVFTTEDSHLSKVRGDGQ
ILAYCLNRLSMKTSNWARIQPLTLADLEKIMQSSHPENLKFTSVEVDTYWLDEPDALAVA
VKLLIERATNQDWMLRVKWLYHLAKNMPQGLESIKIHLEASAAALRNFYSNSLSSGVSNV
IKILQPNVTDESMIPLDPRWNMQAMDIIRNAMDFDPQTDQPEQLFALLESVANKTIIYFD
REKRIFTEANLVSIGGKKLRNSVLRLSFEFHKDPESYHSLPHEIVVNLAAFFELCDALIG
LWVQSSQGMVSDAGVNEILGSVRWRDRFWTVADTVKVDASGLALLALHWHWVLKHLVCRI
PQLLMNHEDKYYREVQTVSEHIQNCLESPTGGFAGVKKLQKFLGRPFPFKDELVVECFSQ
LKVFNKALTIREWMPALGESGWQEDISRLQVVASEGTLKKSLLQAWGLVLRANVLEDVDS
DALKNLVNAQHLELKARGISLGFLEKKHSEASFLLQPDFSTLIQLTRSVQLWPVMEYLAV
LWQYKVTADFMTQACLRRSSKHQQPQIDEEISRHITFCLKHTPVAPQELRDFWSLVHHPE
MTAEERISLWSELFNSTFTSFWSSTVTTHPEYWLTWNPLPGEQQRETPRSLLDPTLKGPG
SLSRAVFSKCCIEIVTSSCRASPWDVSGLPILSSSHVTLGEWVERCQQLRDVSSMLWTNM
AVPVVAEFRRTDAQLQGLVLCRHLAGLAELLPEPRQQEHVHNCRQLLLRDSQAFQHVGET
LGDLARQEALPKELLCLLLTSLRHLFGEVEGKGDLPEPARRGSLWVSLGLLQIQTWLPQA
RFDPAVKREYKLKYAKEELHQLQCEWKTRNLSFQLQTGRDLEDEVILSHSHPHIRLLRQR
IDQLENLICSLSKKQACRPPLPTYEALVQEIHHYVSSIAQATTVQDLLTRLLQALRSDGP
RAAQVAQNLLKEEASWQQSHHQFRRRLAEEFALYPDATAPLQASILQLQHGMRLVAGEVH
ASLQGGLAGADRLGALATSLLAFPSVGPAFPTYYAHADALCSVKSEEVLRGLSKLILKRS
GGRELEEKGQSPCTSREQLLLNALLYLRSHVLCKGELDQRALQLFRHACQEIINEWDEQE
RIAQEKAEQESSLYRYRGRTPRTALSEEEEEERAFRSQFPLHEKDFADILVEPTLEEKGP
SGGQEEEATPGPAVLSQSSMQAVMRIHQQLCLGFARSLWYQQSPPPHGTEHYLSLFLSCY
QTGASLVTHFYPLMGVELNDQLLGSQLLACTLSHNTLFGEVTSDLMVKPDGPYDFYHHPN
IPEARHCQPVLQGFSEAVHRLLQDWPEHPALEQLLVVMDRICSFPLSSPISKFLNGLEIL
LAKAQDWEENASRALSLRKHLDLVSQLIIRWRKLELNCWSMSLDNTMKRHTEKSTKHWFS
IYQMLEKHMQEQTEEQEDDKQMTLMLLVSTLQAFIEGSSLGEFHIRLQMLLVFHCHVLLM
PQVEGKDALCSVLWNLYHYYKQFFNRVQAKIVELRSPLEKELKEFVKISKWNDVSFWSIK
QSVEKTHRTLFKFMKKFEAVLSEPCRSSLAEGDEEEQPDSLPRPTGAAASKESPIQRLNR
VLRETLLARPAAVQGAVPEQCLGAPLPSEGALLRRLPKLLKRMRKMCLTLIQGSPLPCLV
EGLDQFTGDVISFMSELQSLKVDPSAEKEKQRSEAKHILMQKQRALADLFKHLTKTGLSY
RKGLSWARTKNPQEMLHLHPLDLQSALSIVSSTQGADSRLLTEISSSWEGCQKYFYRSLA
RHVRLIAVLAAPAKEVGAGHVERCKGFSAHLMKVLIRQRRSLTVLTEQWILLRNLLSCVQ
EMDGRLTGPPVYPVAFPPQDGVQQWTERLQHLAMQTQVLLEQLSWLLQCCPAVGPAPGHA
PYLEDPERLQGLLSPAARDLIPSDLTFPSPAPETQLPSGCLMRKQDPRWQQSTVRLTEML
KTVKTVKADVDRIRQQSCEALFHSWKDFEVCSSGLSCLSKVSAHLQGLESLFILPGVEGE
QTDPQMALVESMEYVRREINKATDDFTTWKTHLLTPGNQEGNQMLDEGFVEDFSEQTETA
IRAILCAIQNLAERNSKKTEESTDQARPQEEDETAGFESLQLGHLTKLLEEDFWADVSTL
HVQRIISAVSELVERLKSSGEDGTAAKHTFFTQSCCLLVRLVPVLSRYSDLVLFFLTMSL
ATHRSTAKLLSVLAQIFTELAQKGFCLPKEFMEDSAGEGATEFHDYEGGGIGEGEGMKDV
SDQIENEEQAEDTFQKGQEKDKEDPDSKSDIKGEDNAIEMSEDFDGKMHDGELEEQEEDD
EKSDSETGDLDKQMGDLNGEEADKLDERLWGDDDDEEDEEEDSKTEETGPGMDEEDSELV
AKDDNLDAGKSNREKTRQDKKEEKEEAEADDDGRGQDKINEQIDEREYDENEVDPYHGNE
EKLPEPEALDLPDDLNLDSEDKDGDGDTDHEDGEEENPLEIKEQPKDTEEAGHEAEDINE
ETEADQDEGQAQPQPEGGHSEDDKGEEGEEEMDTGADDGDQDAAEHPEEDTEEAPLSSED
KDKDTSEESPEKDTPLDQGLQPQTQEKEEGESSDMEEPVPEPTERKEHESCGQTGLESVQ
SEQAVELAGAAPEKEQGREEHGSGAADANQAEGHESSFMARMASQKHTRKNTQSFKRKPG
QADNERSLGDHSERVHKRLRTMDTESRAEQDPAQPQAQAEDAEAFEHIKQGSEPYDAQTY
DVASTEQQQSAKDSSKAHEEEEVEDTSVDPEEQEELRAVDTEPLKPEEVKSGSTAQPGET
GSEEMEMETQTVKTEEDQHPRTDPSHEETENEKPERSRDSTIHTAHQLLVDTIFQPFLKD
VNELRQELERQLETWQPHESGNPEEEKAAAEMWQSYLVLTAPLSQQLCEQLRLILEPTQA
AKLKGDYRTGKRLNMRKVIPYIASQFRKDKIWLRRTKPSKRQYQICLAIDDSSSMVDNHT
KQLAFESLAVIGNALTLLEVGQIAVCSFGESVKLLHPFHEQFSDYSGSQILRLCKFQQKK
TKIAQFLESVANMFAAAQQLSQNVSPEIAQLLLVVSDGRGLFLEGKDRVLAAVQAARNAN
IFVIFVVLDNPSSRDSILDIKVPIFKGPGEMPEIRSYMEEFPFPFYIILRDVNALPETLS
DALRQWFELVTASDHA
Download sequence
Identical sequences E1BC24
ENSBTAP00000002157 ENSBTAP00000002157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]