SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002325 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002325
Domain Number 1 Region: 292-529
Classification Level Classification E-value
Superfamily VPS9 domain 5.75e-35
Family VPS9 domain 0.0035
Further Details:      
 
Domain Number 2 Region: 51-154
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000366
Family SH2 domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002325   Gene: ENSBTAG00000001775   Transcript: ENSBTAT00000002325
Sequence length 562
Comment pep:known_by_projection chromosome:UMD3.1:18:48851897:48860406:-1 gene:ENSBTAG00000001775 transcript:ENSBTAT00000002325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAQPEDKASPGPTDQERLIPSQANGAGETPLRVLGTPESLLRLQRTWGVWQIPELDAHS
AKALLDLWPPGSFLVIGHHPRQVLVLKTGSSPGEVNTYQIQKLPGGVCLESSKLCMPDLP
HLLAFLSASRDILPRTLLLPPPTLGPEDQNTDPLQIGSIQLSTSRRVLFLVNNLYLETHR
GWGMEQTLPETTPETAERHGPAPRNPAPHRVSWVEGPLSPEEHHLRPALASLVEEKEDEE
EEDDKDDEEGPEDMLTQHVRALARARSSYVAKQFRSFRARLTSGAGGPHRPGDPATELLQ
DVRHLLTDLQDHLAKDPDVRAVFASRGPGAPQKEEELGPAVEAALYRAVLAPLKPALWMR
LRTLRAPELRQLRRRQVALRAEAGPPGAQGAGREKRSPAPALRSRIHERLAHLHAACAPR
RKVSLLLAVCSDVYEGLARGENQEPLGADAFLPALTEELIWSPDIGETQLDVEFLMELLD
PDELRGEAGYYLTTWFGALYHIAHYEPDTARAHKGLSSEVRASLRQWHRRRTLHRQSPSG
DQAKLPFEEPWAMEIMQETKDD
Download sequence
Identical sequences F1N2I8
ENSBTAP00000002325 ENSBTAP00000002325 NP_001291685.1.59421 NP_001291685.1.76553 XP_005219159.1.76553 XP_010813230.1.76553 XP_010813231.1.76553 XP_015331340.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]