SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002505 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002505
Domain Number 1 Region: 171-417
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.43e-87
Family Eukaryotic proteases 0.0002
Further Details:      
 
Domain Number 2 Region: 37-156
Classification Level Classification E-value
Superfamily SEA domain 3.01e-24
Family SEA domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002505   Gene: ENSBTAG00000001925   Transcript: ENSBTAT00000002505
Sequence length 418
Comment pep:known_by_projection chromosome:UMD3.1:6:85255406:85318173:-1 gene:ENSBTAG00000001925 transcript:ENSBTAT00000002505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRPARVTSASRSLNPYLVFFVVVAVVVILAVIIGLLVYFLAFDQKSYFYQSSIQILGKQ
YSDELSSPATEKYRTLSGRIESMITKTFKESDLKNEFIKAHVVKLRQSGNNVIADIIMKF
KFTRRINEASMKSRIESILRQMPNNSEDLNMNPTQVILAITGQDTIQLFTRECGVRSDLI
TLSEERIIGGSKAEKGDWPWQVSLQWSSSHRCGGALISNRWILSAAHCFRSHSDPRQWIA
TFGTSTISPQLRVGVRNILIHDNYKPETHENDIALVQLDREVTFNRYIHTVCLPEANQAI
SAGSTAYVTGWGSQSYSGSTVSDLNQGRVNIISNTVCNTPAGYNGAVLSGMLCAGLPEGG
VDACQGDSGGPLVQEDSRQHWFIVGIVSWGYQCGLPDKPGVYTRVTAYRDWITQQTGI
Download sequence
Identical sequences F1N205
ENSBTAP00000002505 ENSBTAP00000002505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]