SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002574 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002574
Domain Number 1 Region: 210-480
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-79
Family Protein kinases, catalytic subunit 0.000000166
Further Details:      
 
Domain Number 2 Region: 117-251
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-36
Family SH2 domain 0.00038
Further Details:      
 
Domain Number 3 Region: 57-139
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000227
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002574   Gene: ENSBTAG00000001985   Transcript: ENSBTAT00000002574
Sequence length 494
Comment pep:known chromosome:UMD3.1:13:54591299:54597058:1 gene:ENSBTAG00000001985 transcript:ENSBTAT00000002574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPFLRKRLAFLSFFWDKIWPAGAPRFPDPDADLELEPAAEEPSTAEPCSPPAPVQLFRA
LCDFTARRAEELSVSRGDRLHALREEGGCILARKLSGWPCTGLVPITYVAKVAPETLSDQ
PWYFSGISRTQAQQLLLSAPNAPGAFLVRPSESSHGDFSLSVRAQTKVCHYRISMAADGS
LYLQKDRLFPSLDELLAYYKANWKLIQSPLLQPCTAQKSLEQDEWERPHSEFTLRRKLGE
GYFGEVWEGLWLGSMPVAVKVIRPGDVKLADLAQEIQTLKSLRHERLIRLHAVCSAGEPV
YIVTELMRKGSLQAFLGSPEGQALSPPFLLTFACQVAEGMSYLEEQRIVHRDLAARNVLV
GDDLACKVADFGLARLLKDDVYSPRSGSKIPVKWTAPEAASYCVYSPKSDVWSFGVLLYE
VFTYGRCPYEGMSNHETLQQIARGYRLPRPAACPAEVYALMLGCWRRCPEERPDFTTLRE
KLGATSRRRRPALT
Download sequence
Identical sequences F1N1Q0
NP_001179473.1.59421 NP_001179473.1.76553 XP_019827609.1.53367 ENSBTAP00000002574 ENSBTAP00000002574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]