SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002578 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002578
Domain Number 1 Region: 114-305
Classification Level Classification E-value
Superfamily PH domain-like 7.12e-41
Family Pleckstrin-homology domain (PH domain) 0.0088
Further Details:      
 
Domain Number 2 Region: 3-83,134-172
Classification Level Classification E-value
Superfamily EF-hand 0.00000708
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002578   Gene: ENSBTAG00000001987   Transcript: ENSBTAT00000002578
Sequence length 585
Comment pep:known chromosome:UMD3.1:15:43509670:43585976:-1 gene:ENSBTAG00000001987 transcript:ENSBTAT00000002578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLKDELLKGIWHAFTALDLDHSGKVSKSQLKVLSHNLCTVLKVPHDPVALEEHFRDDD
EGPVSNQGYMPYLNKFILEKVQDNFDKIEFNRMCWTLCVKKNLTKNPLFITEEDAFKIWV
IFNFLSEDKYPLIIVPEEIEYLLKKLTEAMGVSWQQEQFENYKINFDDSKDGLSAWELIE
LVGNGQFSKGMDRQTVSMAINEVFNELILDVLKQGYMIKKGHRRKNWTERWFVLKPNIIS
YYVSEDLKDKKGDILLDENCCVESLPDKDGKKCLFLIKCFDKTFEISASDKKKKQEWIQA
IHSTIHLLKLGSPPPHKEARQRRKELRKKLLAEQEELERQMKELQIANENKQQELEAVRK
KLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVR
ELEDMYLKLQEALEDERQARQDEETVRKLQARLLEEESSKRAELEKWHLEQQQAIQTTEA
EKQELENQRVIKEQALQEALEQLQQLELERKQALEQYEGVKKKLEMAAKMTKSWKDKVAH
HEGLIRLIEPGSKNAHLITNWGPAAFTQAELEERQKSWKEKKTTE
Download sequence
Identical sequences A6H709 L8IL87
NP_001073766.2.59421 NP_001073766.2.76553 XP_005896480.1.15283 XP_010827624.1.44457 XP_019830911.1.53367 9913.ENSBTAP00000002578 ENSBTAP00000002578 ENSBTAP00000002578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]