SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002628 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000002628
Domain Number - Region: 145-190
Classification Level Classification E-value
Superfamily EF-hand 0.0158
Family Calmodulin-like 0.08
Further Details:      
 
Domain Number - Region: 197-317
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0765
Family RIO1-like kinases 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002628   Gene: ENSBTAG00000002028   Transcript: ENSBTAT00000002628
Sequence length 428
Comment pep:known chromosome:UMD3.1:3:50658412:50787190:1 gene:ENSBTAG00000002028 transcript:ENSBTAT00000002628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARSLCPGAWLRKPCYLQARFSYVRMKYLFFSWLAVFVGSWIIYVQYSTYTELCRGKDCK
KIICDKYKTGVIDGPACNSLCVTETLYFGKCLSTKPNNQMYLGIWDNLPGVVKCQMEQAL
HLDFGTELEPRKEIVLFDKPTRGTTVQKFKEMVYSLFKAKLGDQGNLSELVNLILTVADG
DKDGQVSLGEAKSAWALLQLNEFLLMVILQDKEHTPKLMGFCGDLYVMESVEYTSLYGIS
LPWVIELFIPSGFRRSMDQLFTPSWPRKAKIAIGLLEFVEDVFHGPYGNFLMCDTSAKNL
GYNDKYDLKMVDMRKIVPETNLKELIKDRHCESDLDCVYGTDCRTSCDQSTMKCTSEVIQ
PNLAKACQLLKDYLLRGAPSEIREELEKQLYSCIALKVTANQMEMEHSLILNNLKTLLWK
KISYTNDS
Download sequence
Identical sequences A4FV51 L8IL93
NP_001076969.1.59421 NP_001076969.1.76553 XP_005894742.1.15283 XP_006061384.1.26621 XP_012015266.1.54773 XP_017901254.1.57651 XP_019812601.1.53367 ENSBTAP00000002628 ENSBTAP00000002628 9913.ENSBTAP00000002628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]