SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002672 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002672
Domain Number 1 Region: 29-170
Classification Level Classification E-value
Superfamily EF-hand 4.21e-34
Family Calmodulin-like 0.00000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002672   Gene: ENSBTAG00000002066   Transcript: ENSBTAT00000002672
Sequence length 175
Comment pep:known_by_projection chromosome:UMD3.1:4:77860261:77862353:1 gene:ENSBTAG00000002066 transcript:ENSBTAT00000002672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QASRKAGTRGKAAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKSDLRET
YSQLGKVNVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRLFDPSGKG
VVNKDEFRQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
Download sequence
Identical sequences F1N2V9
ENSBTAP00000002672 9913.ENSBTAP00000002672 ENSBTAP00000002672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]