SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002674 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002674
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.73e-45
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002674   Gene: ENSBTAG00000002068   Transcript: ENSBTAT00000002674
Sequence length 199
Comment pep:known chromosome:UMD3.1:3:9878839:9886647:1 gene:ENSBTAG00000002068 transcript:ENSBTAT00000002674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANRGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGT
VLCELINGLYPEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGK
NMACVQRTLMNLGGLAVARDDGLFSGDPNWFPKKSKENPRYFSDNQLQEGKNVIGLQMGT
NRGASQAGMTGYGMPRQIL
Download sequence
Identical sequences Q5E9F5
ENSBTAP00000002674 ENSBTAP00000002674 NP_001013617.1.59421 NP_001013617.1.76553 XP_004002705.1.66739 XP_004002706.1.66739 XP_004002707.1.66739 XP_005892141.1.15283 XP_010845168.1.44457 XP_012013908.1.54773 XP_012013909.1.54773 XP_012013910.1.54773 XP_019843817.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]