SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002709 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002709
Domain Number 1 Region: 10-251
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.1e-69
Family Eukaryotic proteases 0.0000949
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002709   Gene: ENSBTAG00000002100   Transcript: ENSBTAT00000002709
Sequence length 258
Comment pep:known_by_projection chromosome:UMD3.1:7:44797942:44803445:1 gene:ENSBTAG00000002100 transcript:ENSBTAT00000002709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLVVLEALWAGGNTFETHIIGGRDAVPHSRPYMVSLQKSSGSHQCGGVLLHQNWVLT
AAHCLTQPTQQLRLVLGLHVLGEISPIYRIRKVVRHPEYKPVPHLENDLALLKLDGKVKP
SRTIQPLALPRGRQMVATGTRCSLAGWGLTHQPGNLARVLQELDVHVLDTRMCNNSRFWH
GNISSHMICLAADSKNQAPCKGDSGGPVVCKRGQVAGILSFSSENCTDIFKPPVAVAVAP
YMPWIKKVLRHNGSPPSP
Download sequence
Identical sequences E1BP32
9913.ENSBTAP00000002709 ENSBTAP00000002709 XP_002689185.1.76553 XP_589755.4.59421 ENSBTAP00000002709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]