SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002710 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002710
Domain Number 1 Region: 66-314
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.97e-60
Family Glycerophosphoryl diester phosphodiesterase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002710   Gene: ENSBTAG00000002101   Transcript: ENSBTAT00000002710
Sequence length 331
Comment pep:known chromosome:UMD3.1:25:17210001:17237789:-1 gene:ENSBTAG00000002101 transcript:ENSBTAT00000002710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLWEEQGGLMGPFSFLLLVLLLLTRSPFNACLFTGSLYLLLRLFSFEPVPSRRAMQVLK
PRDRVSAIAHRGGSHDAPENTLAAIRQAAKNGAAGVELDLEFTADGIPVLMHDSTVDRTT
DGTGRLCDLTFEQIRKLNPAANHRLRNDFPNEKIPTLREAVAECLNHNLTIFFDVKGHAY
KATDALKKVYMEFPKLYNNSIVCSFLPEVIYKMRQTDQNVVTALIHRPWSLSHTGDGKPR
FESFWKQSMFVALDILLDWSMHNILWYLCGVSAFLAQKDFISPDYVKKWSAKGIQVVAWT
VNTFDEKSYYESHLGSSYITDSMLEDCTPEF
Download sequence
Identical sequences Q3T0T0
ENSBTAP00000002710 9913.ENSBTAP00000002710 ENSBTAP00000002710 NP_001029858.1.59421 NP_001029858.1.76553 XP_010835420.1.44457 XP_019843723.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]