SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002847 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002847
Domain Number 1 Region: 764-1018
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.31e-78
Family Eukaryotic proteases 0.0000838
Further Details:      
 
Domain Number 2 Region: 432-552
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.7e-35
Family Frizzled cysteine-rich domain 0.00011
Further Details:      
 
Domain Number 3 Region: 116-229
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.4e-29
Family Frizzled cysteine-rich domain 0.00085
Further Details:      
 
Domain Number 4 Region: 559-596
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 633-675
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 285-321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 321-359
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000956
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 248-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 9 Region: 362-403
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 10 Region: 599-631
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000812
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 11 Region: 690-768
Classification Level Classification E-value
Superfamily SRCR-like 0.0000115
Family Scavenger receptor cysteine-rich (SRCR) domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002847   Gene: ENSBTAG00000002199   Transcript: ENSBTAT00000002847
Sequence length 1026
Comment pep:known_by_projection chromosome:UMD3.1:6:67925293:68176596:-1 gene:ENSBTAG00000002199 transcript:ENSBTAT00000002847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLGADDDNMGGGCSRKLTTVNILRFLLLVLIPCICALIVLLVILLSFVGTLKKAYFKSNG
SEPLVTDSKVHVSDVILNTTYNDESTVTSAAHPTQHIPAWTMDASLSADQNHRNTSACMN
ITHSQCQILPYYTTLTSPLSIVKSMEMEKFLKFFTYLHRLGCYQHIMLFGCSLAFPKCIR
DGADSHGLLPCRSFCESAKEGCESVLGMVNASWPDFLKCSQFRNQSENSNVSRICFSPQQ
ENEKQSLCRGGESFLCTSGICVPRKLQCNGYNDCDDWSDEAHCNCSENLFHCHTGKCLNY
SLVCDGYDDCGDLSDEQNCDCNPIEEHRCGDGRCIAIEWVCDGDHDCVDKSDEVNCSCHS
QGLVECRNGQCIPSTFQCDGDEDCKDGSDEESCSDGQTLCQEGDQRCLYSSCLDSCGGNS
LCDPSNSVNNCSQCEPITLELCLNLPYNHTNFPNYLGHRTQKEASISWESSLFPALVQTN
CYKYLMFFACTILVPKCDEDTQQRIPPCRALCEHSKERCESVLGIVGLQWPEDTDCNQFP
EENADNQTCLMPDDEVEECSPSHFKCRSGRCVLASRRCDGQADCDDDSDEENCGCKERDL
WECPSSKQCLKHTVICDGFPDCPDNMDEKNCSFCQADELECANHECVSRDRWCDGEADCI
DSSDEWDCVTLSANVNSSFLMARRSAMEHHVCADGWQETLSQLACKQMGLGEPSMTKLIE
EQEQDQQWLTLHSNWESLNATTLQQLLVKGQSCYSRSKISLLCTKQDCGRRPAARMNKRI
LGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVFGINN
LDHPSTFMQMRLVKTIILHPRYSRAVVDYDISIVELSQDINETSYVRPVCLPSPDQSLEP
DTYCYITGWGHMGNKKKKKNPVPFKLQEGEVRVISLEQCQSYFDMKTITNRMICAGYESG
TVDSCMGDSGGPLVCEKPGGQWTLFGLTSWGSVCFSKVLGPGVYSNVTYFVKWIERQIYI
RTFLLN
Download sequence
Identical sequences F1N2B7
ENSBTAP00000002847 9913.ENSBTAP00000002847 ENSBTAP00000002847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]