SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002912 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002912
Domain Number 1 Region: 17-275
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.66e-77
Family Eukaryotic proteases 0.00000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002912   Gene: ENSBTAG00000002257   Transcript: ENSBTAT00000002912
Sequence length 276
Comment pep:known_by_projection chromosome:UMD3.1:18:57456022:57458588:-1 gene:ENSBTAG00000002257 transcript:ENSBTAT00000002912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTLQLIMFALVTGHVGGETRIIKGYECPPHSQPWQAALFQKTRLLCGATLIAPRWLLTA
AHCRKPWVRGPGRGREGRRLEMERRRRVSHFSRYVVHLGAHSLGRQDGCEQTRTATKSFP
HPDFNNSLPNKDHRNDIMLVKMVTPAHLTWAVRPLTVSPRCVPAGANCLISGWGTMSSPQ
LHLPHTLRCANVTIIKHRECEDAYPGNITDTMVCASVRKEGKDSCQGDSGGPLVCNGSLQ
GIISWGQDPCAVSKKPGVYTKVCKYVDWIQKTMENN
Download sequence
Identical sequences F1N4M1
ENSBTAP00000002912 ENSBTAP00000002912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]