SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002923 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002923
Domain Number 1 Region: 13-247
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.14e-81
Family Eukaryotic proteases 0.00000748
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002923   Gene: ENSBTAG00000030484   Transcript: ENSBTAT00000002923
Sequence length 248
Comment pep:known_by_projection chromosome:UMD3.1:18:57461617:57465567:-1 gene:ENSBTAG00000030484 transcript:ENSBTAT00000002923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRASIFLLLCFVGFSHEAKEKITNGTECIPHSQPWQVGLFEGTRLRCGGVLIDRRWVLTA
AHCSGSRYWVRLGEHSLSKLDWTEQIRRSGLSVTHPSYRGNLGNHDNDLRLLRLGTPVRL
TTSVQPLPLPTTCATAGTECHISGWGTTNHPWSPFPDRLQCLSLSIVSNATCRAVFPGRI
TDNMVCAGGKAGEDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQEGIPGVYTNVCKYVDW
IQTVMRSN
Download sequence
Identical sequences E1BE09
9913.ENSBTAP00000002923 ENSBTAP00000002923 NP_001180119.1.59421 NP_001180119.1.76553 XP_005219434.1.76553 ENSBTAP00000002923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]