SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003033 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003033
Domain Number 1 Region: 609-714
Classification Level Classification E-value
Superfamily SH2 domain 4.85e-32
Family SH2 domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 319-423
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-29
Family SH2 domain 0.00000237
Further Details:      
 
Domain Number 3 Region: 105-257
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000000000589
Family BCR-homology GTPase activation domain (BH-domain) 0.00031
Further Details:      
 
Domain Number 4 Region: 5-82
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000002
Family SH3-domain 0.0000918
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003033   Gene: ENSBTAG00000002350   Transcript: ENSBTAT00000003033
Sequence length 724
Comment pep:known chromosome:UMD3.1:7:4987071:4999686:-1 gene:ENSBTAG00000002350 transcript:ENSBTAT00000003033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGNERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGPPEPGLTLPDLPEQFSP
PDVAPPILVKLVEAIERTGLDSYRPEPPAVRTDWSLSDVEQWDAAALSDGVKGFLLALPA
PLVTPEAAAEAHRALREAAGPVGPALEPPTLPLHHALTLRFLLQHLGRVAGRAPAPGPAV
RALGATFGPLLLRAPPPPSPPPGGAPDGTEPTPDFPALLVEKLLQEHLEEQEVAPPALPP
KPPKTKPAPTGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGE
YTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLLYP
VSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAF
NETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQ
ELRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQ
YSLMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGD
TKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPP
PAAR
Download sequence
Identical sequences P23726
9913.ENSBTAP00000003033 ENSBTAP00000003033 NP_777001.1.59421 NP_777001.1.76553 XP_006057992.1.26621 ENSBTAP00000003033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]