SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003130 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003130
Domain Number 1 Region: 66-185,261-365
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.59e-63
Family FabD-like 0.00011
Further Details:      
 
Domain Number 2 Region: 194-268
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.000000798
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003130   Gene: ENSBTAG00000002413   Transcript: ENSBTAT00000003130
Sequence length 387
Comment pep:known_by_projection chromosome:UMD3.1:5:114576427:114588012:-1 gene:ENSBTAG00000002413 transcript:ENSBTAT00000003130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRVARAARAWARSVSGRRGSSNCPRPPPAAVDVAALLRDATAADGGSQDAQAAAGRRE
PGQCSVLLFPGQGSQVVGMGRGLLRYPRVRELYDAARRVLGYDLLELSLRGPQEALDRTV
HCQPAVFVASLAAVEKLHHLQPAVIENCVAAAGFSVGEFAALVFAGAMEFSEGLYAVKIR
AEAMQEASEAVPSGMLSVLGQRQSKFTVACLEAQEHCKTRGIENPVCVVSNYLFPDCRVI
SGHLEALQFLQKNSSKYHFRRTKMLPVSGGFHTRLMEPAVEPLVQVLKAIDVKKPLVSVH
SNVDGNRYMHPKHIQKLLAQQVVSPVKWEQTMHAIYERRKGTAFPQTFEVGPGKQLGAIL
RSCNLQAWRSYSHVEVLEAGEDPEEPL
Download sequence
Identical sequences E1BPG0
ENSBTAP00000003130 9913.ENSBTAP00000003130 ENSBTAP00000003130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]