SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003165 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003165
Domain Number 1 Region: 43-324
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 5.36e-114
Family Inorganic pyrophosphatase 0.0000000472
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003165   Gene: ENSBTAG00000002428   Transcript: ENSBTAT00000003165
Sequence length 327
Comment pep:known chromosome:UMD3.1:6:20984354:21082553:1 gene:ENSBTAG00000002428 transcript:ENSBTAT00000003165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLPLLRTSWAWPVGAAAAASARLLRGASAGPGPRRTMALYRTEERGQPHSPDYRLFF
KNVAGHYISPFHDIPLKVDSEENVFNMVVEVPRWTNAKMEIATKEPLNPIKQDVKDGKLR
YVANIFPHKGYIWNYGALPQTWEDPHRKDKSTDCCGDNDPIDVCEIGSKVLSRGEVVHVK
ILGVLALIDQGETDWKLIAINVNDPEASKFHDIEDVKKYKPGYLEATLNWFRFYKIPEGK
PENQFAFNGEFKNKAFALEVIKSAHECWRALLMDKCDGGAINCTNVQVCDSPFHCSQEEA
RSLVESVSFSLNKGSNEEDQVWHFLGK
Download sequence
Identical sequences Q2KIV7
NP_001069864.1.59421 NP_001069864.1.76553 ENSBTAP00000003165 9913.ENSBTAP00000003165 ENSBTAP00000003165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]