SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003182 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003182
Domain Number 1 Region: 330-478,515-559
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000243
Family Viral proteases 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003182   Gene: ENSBTAG00000002450   Transcript: ENSBTAT00000003182
Sequence length 576
Comment pep:known_by_projection chromosome:UMD3.1:15:83602863:83605727:1 gene:ENSBTAG00000002450 transcript:ENSBTAT00000003182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVSSEQPSQKDSAEKCKSCTEHCFPKLSENQQDNSNTPQMEMDSKTSSENIDNLQAEGPR
DQTVSPEETVYVTLDVNIKPSKGRKHRLRVTGSSWEARSSEAVRKAVRTPPGRERLVYSA
EGTDAFLNLGMPLRCSPENRHVRVIFSPKRSETGKEEQVFGQFNNTSTDCVKFYIHTVGK
TRKTLLKCRELHKDEYKLCVYAFKGESIRAMSADGRLLSLLEKSDWTLIGNLSIVLDSSQ
LANALEGELFQLELKKSMDARAPAARNSESQEIKPCVLKQTIMEDKHPSLERESDKIRKT
LRIIWIKHRGEKLFELHKTDFGKLTKNCSVEVHRLLSGLSDSVGHLSWHIRKSAGSSACF
VWKGLYISTRRHVMYRTVGEDIESRECAHTHGQCVKGTFAYEKAEDENKHCFLERWFETP
DVELDHAALKVKTQGQQEPEGLCDGKDPGPDSSLVCVTGRPAGEAKSTDACAVIPQDQRE
EKYLEHIQARAAYRTQYIHMHTQKSFQEVVPQPDVATHNTASYFGSGSPVFDSEGSWVTY
TAGFAYKYPQGISSITEFSCTLKIHIYDVKKKHRMW
Download sequence
Identical sequences F1MNU1
ENSBTAP00000003182 ENSBTAP00000003182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]