SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003213 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003213
Domain Number 1 Region: 326-493,576-744
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 6.8e-127
Family Mammalian PLC 0.000000687
Further Details:      
 
Domain Number 2 Region: 168-324
Classification Level Classification E-value
Superfamily EF-hand 8.06e-43
Family EF-hand modules in multidomain proteins 0.03
Further Details:      
 
Domain Number 3 Region: 762-878
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.06e-27
Family PLC-like (P variant) 0.00063
Further Details:      
 
Domain Number 4 Region: 41-154
Classification Level Classification E-value
Superfamily PH domain-like 5.69e-27
Family Pleckstrin-homology domain (PH domain) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003213   Gene: ENSBTAG00000002464   Transcript: ENSBTAT00000003213
Sequence length 1403
Comment pep:known_by_projection chromosome:UMD3.1:16:51607338:51633413:-1 gene:ENSBTAG00000002464 transcript:ENSBTAT00000003213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVPWPLTPSRTKGTVACLAEALLWVGGSVAVSPQWQLGPLVERCMSAMQAGTQMVKLRG
SSKGLVRFYFLDEHRSCIRWRPSRKNEKAKISIDSIQEVSEGRQSEIFQRYPDGSFDPNC
CFSIYHGSHRESLDLVSPSGDEARTWVTGLRYLMAGISDEDSLARRQRTRDQWLKQTFDE
ADKNGDGSLSIGEVLQLLHKLNVNLPRQRVKQMFKEADTDDHQGTLGFEEFCAFYKMMST
RRDLYLLMLTYSNHKDHLDATDLLRFLEVEQKMTGVTLESCRDIIEQFEPCPENKSKGAM
GIDGFTNYTRSPAGDIFNPEHRLVHQDMTQPLSHYFITSSHNTYLAGDQLTSQSRADMYA
RVLQAGCRCVEVDCWDGPDGEPIVHHGYTLTSKILFKDVIETINKYAFIKNEYPVILSIE
NHCSVIQQKKMAQYLTDILGDKLDLSSVSSEDATMLPSPQVLKGKILVKGKKLPANISED
AEEGEVSDEDSADEIDEDCKLLNGDASTNRKRVENIAKRKLDSLMKESKIRDCEDPSDFT
VSTLPPPGKLGPKAEAKKFEEDVEIGEEAGTSRRNSRLLMGSFSKRKKKSSKLKKAASVE
EGDEDLDSQGSQSRGAARQKKTMKLSRALSDLVKYTKSVGTHDVETEVASSWQVSSFSET
KAQQILQQKPAQYLRFNQHQLSRIYPSSYRVDSSNYNPQPFWNAGCQMVALNYQSEGRML
QLNRAKFSANGSCGYVLKPQCMCQGIFNPNSEDPLPGQLKKQLVLRIISGQQLPKPRDSM
LGDRGEIIDPFVEVEVIGLPVDCNKEQTRVVDDNGFNPMWEETLVFTVHMPEIALVRFLV
WDHDPIGRDFIGQRTLAFSSMMPGYRHVYLEGMEEASIFVHVAVSDISGKVKQALGLKGL
FLRGPKPGSLDSHAAGRPLPRPSVSQRLLRRTASAPTKSQKPGRKAFPELVLGLQDTGSE
GEAGDVAPSSPGPIPEAPTREEPGSRSPREPRPFSMQRSVSSLCSLETIAEEPALGPGPL
LPGATPPSHAPGGPQCSTGLSTLSASPPRSHASAEPAPGSRQWACSTGGPAGACKGAPSG
HIEGKGHPRALGHVPRRAKSEGQVPSESLGGRWPLAGPCPTVSLDATGGDRLWQRLEPGS
HRGSVSSSSSLSSSDTVIELALPGLGLGLGCDSLPGTLAGRLPLRPCSAPVACLDPPAVT
KSKSNPNLRAAGQLPVGPDRLQPLPLAPGPPWRRLPLAGLPDCTVAAKSKSLGDLTADDF
APRVESLGRGLGLAGERPAGRRVRPDALTEQLRWLTGFQQAGDITSPTSLGPTGEGVAGA
PGFLRRSSSRSQSRVRAIASRARQAQERQQRLRGPRGPPEEERGTPEGACSVGQEGCGDV
QAPSKGATHQPLGAAATGLLLRF
Download sequence
Identical sequences E1BNT8
9913.ENSBTAP00000003213 ENSBTAP00000003213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]