SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003320 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003320
Domain Number 1 Region: 6-205
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 2.35e-60
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003320   Gene: ENSBTAG00000002566   Transcript: ENSBTAT00000003320
Sequence length 209
Comment pep:known_by_projection chromosome:UMD3.1:7:4760644:4798974:-1 gene:ENSBTAG00000002566 transcript:ENSBTAT00000003320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPA
LWEKHSPQLVVHVGVSGMATAVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSII
DMDAVCKRVTTLGLDVSVTISQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQ
LGRALRAIIEEMLDLLEQSEGKINCCHEH
Download sequence
Identical sequences E1BN15
ENSBTAP00000003320 NP_001103453.1.59421 NP_001103453.1.76553 XP_006058013.1.26621 XP_011984108.1.54773 XP_017906924.1.57651 XP_019819395.1.53367 ENSBTAP00000003320 9913.ENSBTAP00000003320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]