SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003341 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003341
Domain Number 1 Region: 37-212
Classification Level Classification E-value
Superfamily Lysozyme-like 3.75e-24
Family G-type lysozyme 0.00000729
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003341   Gene: ENSBTAG00000002582   Transcript: ENSBTAT00000003341
Sequence length 212
Comment pep:known chromosome:UMD3.1:11:4335801:4346724:-1 gene:ENSBTAG00000002582 transcript:ENSBTAT00000003341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSFALFGGLFVLIGTSRGSHSFTHTMSPRLHFRLYHGCYGDVMIMETPGIPCDNTRMIA
CGIRGSEMFAEMDLKALQSYQILIKEIGLRHCVDPALIAAIISRESHGGTILLDGWDHTG
LKFGLMQLDKKIHHPVGTWDGKEHLLQAVGILTDSIKAIQKKFPSWSVAQHLKGGLSAFK
SGTEAIATSADIQADYVNDVLARAKFYKKRGF
Download sequence
Identical sequences A5PJT9 L8IRC9
9913.ENSBTAP00000003341 NP_001092546.1.59421 NP_001092546.1.76553 XP_005892302.1.15283 XP_010827932.1.44457 ENSBTAP00000003341 ENSBTAP00000003341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]