SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003365 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003365
Domain Number 1 Region: 22-169
Classification Level Classification E-value
Superfamily EF-hand 6.55e-22
Family Calmodulin-like 0.0026
Further Details:      
 
Domain Number 2 Region: 406-469
Classification Level Classification E-value
Superfamily EF-hand 0.0000047
Family Calmodulin-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003365   Gene: ENSBTAG00000002600   Transcript: ENSBTAT00000003365
Sequence length 629
Comment pep:known_by_projection chromosome:UMD3.1:3:82334708:82389287:-1 gene:ENSBTAG00000002600 transcript:ENSBTAT00000003365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAISPGSDAAFSGQKPTHSESPRSKKFLLTEEEIFYMNCRAAYLTVFKSSLDNIISKDQL
YLALQHAGRNPSQKTINKYWTSQTAKLNFDDFCIILRKEKPTSKAELLKSFKQLDVNDNG
SILHTDLYKLLTKKGEKMTREEVNAIINLADVNADGKFDYIKFCKLYMATNEQCLKTTLE
KLEVDSKLRRQQFGSHVEGSPERAPSPVAKASPRIIRKADQESFSNKGDTRNSSLATARQ
FKTSVSFTVTMGADSNQNSKLIEPHSIKEWQCVQSKGCFFLEEDGEIISHQYKMQIAQRS
LVYITIKPLSLSQAEGKPSPWLSVDTALYILKENESQANLQLLYFTELRNRETFGWTGEL
GPGIYWLVPSTTGCRLRKEVKPVTEEAQLVYRDETGELFLTKEFRSTLSDIFEVIDLDGN
GLLSLEEYNFFELRTSGEKCDEDAWAVCRENFDTKKNELTRQGFMDLNLMEANDREGDPR
DLWVTLHSMGYNKALELTEACPFVIDIYADKCKPRIKAVHMEACSGQLEKAICKSVLNKG
NAKVMDGYENIIIYTYKRDTWITAVIENKSDDKVIIHVNNELSENCVNNRGLGIFAVEVA
PNSTMVCQHVMPLNERQEWIYYCVYSLIS
Download sequence
Identical sequences E1BMZ0
ENSBTAP00000003365 ENSBTAP00000003365 NP_001178979.1.59421 NP_001178979.1.76553 XP_019812886.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]