SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003472 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003472
Domain Number 1 Region: 24-358
Classification Level Classification E-value
Superfamily Phosphofructokinase 2.09e-107
Family Phosphofructokinase 0.000000249
Further Details:      
 
Domain Number 2 Region: 350-771
Classification Level Classification E-value
Superfamily Phosphofructokinase 5.76e-107
Family Phosphofructokinase 0.00000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003472   Gene: ENSBTAG00000002683   Transcript: ENSBTAT00000003472
Sequence length 791
Comment pep:known_by_projection chromosome:UMD3.1:13:45500599:45553520:-1 gene:ENSBTAG00000002683 transcript:ENSBTAT00000003472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGHDSPQTPKGSLRKFLEQLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYF
IYEGYQGMVDGGSNIVEADWESVSSILQVGGTIIGSARCQDFRTREGRLKAACNLVQLGI
TSLCVIGGDGSLTGAHIFQTEWSGLLEELARDGKISTEQVQKHGHLNVVGMVGSIDNDFC
GTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFL
PESPPEEGWQENMCIKLSENRARKKRLNIIIVAEGAIDTQNKPITSEQIKELVVTQLGYD
TRVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATPETPACVVSLSGNQAVRLPLME
CVQMTQEVQKAMDERRFKDAVRLRGRSFENNLNTYKRLAIKLPDSEIPKSNCNVGVVNVG
APAAGMNAAVRAAVRVGISEGHKMFAVYDGFEGFAKGQIKEIGWGDVGGWTGQGGSILGT
KRTLPGKYLEDIAAQMRTHGISALLIIGGFEAYLGLLELLAARQKHEEFCVPMVMVPATV
SNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGFCGYLANMGGLAAG
ADAAYIFEEPFDIRDLQSNVEHLTEKMKTSIQRGLVLRNESCSENYTTDFIYQLYSEEGK
GVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMQWISSKLRESVGKGKKFLSEDCVCV
LGISKRTLLFQPVAELKKETDFEHRIPKEQWWLKLRPLMKILAKYKVSFEVSDASQLEPV
QPRGPEEPAAI
Download sequence
Identical sequences E1BCW3
ENSBTAP00000003472 ENSBTAP00000003472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]