SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003532 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003532
Domain Number 1 Region: 5-197
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.07e-61
Family Dual specificity phosphatase-like 0.00000000515
Further Details:      
 
Domain Number 2 Region: 248-461
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 2.42e-41
Family mRNA capping enzyme 0.00018
Further Details:      
 
Domain Number 3 Region: 463-576
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.91e-31
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003532   Gene: ENSBTAG00000002725   Transcript: ENSBTAT00000003532
Sequence length 595
Comment pep:known chromosome:UMD3.1:9:61993719:62225102:1 gene:ENSBTAG00000002725 transcript:ENSBTAT00000003532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVK
MGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERNPPE
LIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDI
EEAPPPPLLPDWCFEDDEDEDEDEDGKKESEPGSSASFGKRRKERLKLGAIFLEGVTVKG
VTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLEQKPYKVSWKADGTRY
MMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYL
IYDIIKFNAQPVGDCDFNIRLQCIEREIINPRHEKMKTGLIDKTQEPFSVRHKPFFDIYA
SRKLLEGNFAKEVSHEMDGLIFQPTGKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEG
LLPQNIGLLYVGGYERPFAQIKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYN
TAMAVCNSISNPVTKEMLFEFIDRCAAASQGQKRKHHPDPDTELMPPPPPKRPLT
Download sequence
Identical sequences L8IWR6 Q2KHX7
ENSBTAP00000003532 9913.ENSBTAP00000003532 ENSBTAP00000003532 NP_001039550.1.59421 NP_001039550.1.76553 XP_005889355.1.15283 XP_006055396.1.26621 XP_010832999.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]