SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003718 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003718
Domain Number 1 Region: 39-213
Classification Level Classification E-value
Superfamily EF-hand 2.59e-47
Family Calmodulin-like 0.0000000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003718   Gene: ENSBTAG00000002865   Transcript: ENSBTAT00000003718
Sequence length 216
Comment pep:known chromosome:UMD3.1:20:2283783:2544502:1 gene:ENSBTAG00000002865 transcript:ENSBTAT00000003718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGF
KNECPSGVVNEETFKQIYAQFFPHGDASMYAHYLFHAFDTTQTGSVKFEDFVTALSILLR
GTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDIFFQ
KMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM
Download sequence
Identical sequences Q5BN37
NP_001013622.1.59421 NP_001013622.1.76553 XP_004016909.1.66739 XP_005694576.1.57651 XP_012001426.1.54773 XP_019838640.1.53367 XP_020770270.1.74333 ENSBTAP00000003718 9913.ENSBTAP00000003718 ENSBTAP00000003718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]