SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003751 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003751
Domain Number 1 Region: 350-452
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000003751
Domain Number - Region: 175-267
Classification Level Classification E-value
Superfamily STAT 0.0255
Family STAT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003751   Gene: ENSBTAG00000002885   Transcript: ENSBTAT00000003751
Sequence length 453
Comment pep:known chromosome:UMD3.1:27:19976214:20056927:1 gene:ENSBTAG00000002885 transcript:ENSBTAT00000003751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWDDFPDQQEDTDSCTESVKFDARSVTALLPPHPKNGPTLQERMKSYKTALITLYLIV
FVVLVPIIGIVAAQLLKWETKNCTVGSVNADISPSPEGKGNGSEDEMRFREAVMERMSNM
ESRIQYLSDNEANLLDAKNFQNFSITTDQRFNDVLFQLNSLLSSIQEHENIIGDISKSLV
GLNTTVLDLQFSIETLNGRVQENAFKQQEEMRKLEERIYNASAEIKSLDEKQVYLEQEIK
GEMKLLNNITNDLRLKDWEHSQTLKNITLLQGPPGPPGEKGDRGPPGQNGIPGFPGLIGT
PGLKGDRGISGLPGVRGFPGPMGKTGKPGLNGQKGQKGEKGSGSMQRQSNTVRLVGGSGP
HEGRVEIFHEGQWGTVCDDRWELRGGLVVCRSLGYKGVQSVHKRAYFGKGTGPIWLNEVF
CFGKESSIEECRIRQWGVRACSHDEDAGVTCTT
Download sequence
Identical sequences P21758
9913.ENSBTAP00000003751 NP_001106711.1.59421 NP_001106711.1.76553 XP_019809139.1.53367 ENSBTAP00000003751 ENSBTAP00000003751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]