SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003767 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003767
Domain Number 1 Region: 422-596,638-696
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.79e-27
Family Prokaryotic proteases 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003767   Gene: ENSBTAG00000036016   Transcript: ENSBTAT00000003767
Sequence length 735
Comment pep:known_by_projection chromosome:UMD3.1:15:83568474:83582435:1 gene:ENSBTAG00000036016 transcript:ENSBTAT00000003767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFIKTEENTSFSATGNDQSTRPEASKDTVIEEACSGTPVDQSLSDIRERNSTIKVKSEV
IEQETSSERQNPHVSTSEKCLFTFSLNERRRKLDHRVFTAFGGPNENIYSVLSADDHFSE
RMKKHVNKNIIVYEEETIKAYINLGMPLRCLPSGSHLKITFGQRSNEKDDQVLRPCKNPD
TECILFHVVAIGKTRKMIVKINELHVQGTTLCVYALKGETIKEALCNDGRFLSNLDTLEW
TLRDHKNIYGKQSIVDIVSGKVLELEILKKLSIKKCTHIKIKPEDENATADISLQALTQS
KSKAHEPEKDGETEDVEHNREKILPCQSLGLDIKHKTRRSISKIKRYYNNNLYKRLRRKI
TRVRRRPSLGRLYAILAIQRETTNLWVKNLQILNKVMMHQYPNFNKEALRIQKYFQEERE
RMKLTTSKQFSMYKHYFGKVTENSVSVAICERLVHLSKSVGFMKWDNNGNTGNATCFVFN
DGFIFTCRHVLHLIVGEGTDRKSWPDIISTCVKVTFTYKEFCPNDVDWLSFEPWFMVSGE
TLDYAILKLSENGNGFPPGLSKLIFRQPSDGLLYLIGHPEGQIKKIDGCSVISLEQRLER
YKEHYSDGVVPGSCSDIYNAFPMFTQRSFLSEVWSTNTLSYDTYFSSGSSGSPVFNASGK
LVAMHSFGHFYSHVNKAYALIEFGYSMESILCDIKQKDENLYKLLQEEKNESHNEEKDNK
QELSLQESQIESMQY
Download sequence
Identical sequences E1BGY1
NP_001192583.1.59421 NP_001192583.1.76553 XP_005216653.2.76553 XP_005216654.1.76553 XP_010811254.1.76553 ENSBTAP00000003767 9913.ENSBTAP00000003767 ENSBTAP00000003767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]