SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003800 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003800
Domain Number 1 Region: 36-203
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.81e-42
Family Dual specificity phosphatase-like 0.0000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003800   Gene: ENSBTAG00000002924   Transcript: ENSBTAT00000003800
Sequence length 219
Comment pep:known chromosome:UMD3.1:28:30993339:31024892:-1 gene:ENSBTAG00000002924 transcript:ENSBTAT00000003800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSGESKTGLKNVYPSAKKLLPKVEEGEAEDYCTPGAFELERLFWKGSPQYTHVNEVWPK
LYIGDETTALDRYGLQKAGFTHVLNAAHGRWNVDTGPDYYRDMAIEYHGVEADDLPSFDL
SVFFYPAAAFIDAALRYDHNKILVHCVMGRSRSATLVLAYLMIHRNMTLVDAIQQVAKNR
CVLPNRGFLKQLRELDRQLVQQRRQAQQGEDAEKCEQEP
Download sequence
Identical sequences P0C591
9913.ENSBTAP00000003800 ENSBTAP00000003800 XP_005226533.1.76553 XP_019809368.1.53367 ENSBTAP00000003800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]