SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003801 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003801
Domain Number 1 Region: 27-191
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.72e-41
Family Dual specificity phosphatase-like 0.0000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003801   Gene: ENSBTAG00000023039   Transcript: ENSBTAT00000003801
Sequence length 198
Comment pep:known chromosome:UMD3.1:28:31044244:31048603:-1 gene:ENSBTAG00000023039 transcript:ENSBTAT00000003801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLQKQDLRRPKIHGSVRVSPYQPPTLASLQRLLWVRRAAMLNHINEVWPNLFLGDAYA
ARDKKKLTQLGITHVVNVAAGKFQVDTGAKFYRGMPLEYYGIEADDNPFFDLSVYFLPVA
RYIRSALSVPQGRVLVHCAMGVSRSATVVLAFLMICENMTLVEAIQTVQAHRDICPNSGF
LRQLQVLDNRLGRETGRL
Download sequence
Identical sequences F1ME76
ENSBTAP00000003801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]