SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003828 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003828
Domain Number 1 Region: 550-817
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-80
Family Protein kinases, catalytic subunit 0.000001
Further Details:      
 
Domain Number 2 Region: 12-283
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.81e-53
Family FCH domain 0.02
Further Details:      
 
Domain Number 3 Region: 440-578
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-27
Family SH2 domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003828   Gene: ENSBTAG00000002941   Transcript: ENSBTAT00000003828
Sequence length 822
Comment pep:known chromosome:UMD3.1:21:22192640:22204117:-1 gene:ENSBTAG00000002941 transcript:ENSBTAT00000003828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFSSELCNPQGHGAVQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQS
RGIGPHSLISQSWTELTSQTEGLSRVLRQHAEDLNSGPLSKLSLLIRERQQLRKTYNEQW
QQLQQEFTKSHSQDIEKLKSQYRALARDSAQARRKYQEAGKDKDRDKAKDKYVRSLWKLF
AHHNRYVLGVRAAQLHHQHHHRLMLPSLLQSLQDLHQEMACILKETLQEYLEISSLVQDE
VVTIHREMAAAVARIQPEAEYQGFLQQYGSAPDIPPCVTFDESLLEETELLEPGELQLNE
LTVESVQHTLTSVTDDLAAATQTVLSRQEAVTQLQRELWNEEQTTHPRERVQLLGKKQAL
QEALQGLQVALCRQAKLQAQQELLQAKLEWLGPGEPQPVLLLQDDRHSTSSSEQEREGGR
TPTLEILKSHISGIFRPKFSLPPPLQLVPEVQKPLHEQVWYHGAIPRTEVAELLTHSGDF
LVRESQGKQEYVLSVLWDGQPRHFIIQSADNLYRLEGDGFPSIPLLIDHLLRSQQPLTKK
SGIILNRAVPKDKWALSHEDLVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDL
KAKFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGARLRVKTL
LQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKISDFGMSREEADGIYAASGGLR
QVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYPNLSNQQTREFVEKGGRLP
CPELCPDAVFRLMEQCWAYEPGQRPTFSVIYQELQSIRKRHR
Download sequence
Identical sequences Q5E9H3
9913.ENSBTAP00000003828 ENSBTAP00000003828 ENSBTAP00000003828 NP_001027471.1.59421 NP_001027471.1.76553 XP_010815249.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]