SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003878 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003878
Domain Number 1 Region: 349-456
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-31
Family SH2 domain 0.00000351
Further Details:      
 
Domain Number 2 Region: 54-162
Classification Level Classification E-value
Superfamily SH2 domain 1.14e-30
Family SH2 domain 0.00000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003878   Gene: ENSBTAG00000002979   Transcript: ENSBTAT00000003878
Sequence length 461
Comment pep:novel chromosome:UMD3.1:3:100565315:100666691:1 gene:ENSBTAG00000002979 transcript:ENSBTAT00000003878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAITNGIKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELISHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRKEGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYGSLKELVLHYQRTSLVQHNDSLNVRLAYPVHAQMPSLCR
Download sequence
Identical sequences F1MDQ5 L8IQQ2
ENSBTAP00000003878 XP_005894275.1.15283 XP_010846168.1.44457 XP_019813110.1.53367 ENSBTAP00000003878 9913.ENSBTAP00000003878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]