SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003969 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003969
Domain Number 1 Region: 2-107
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-34
Family Calponin-homology domain, CH-domain 0.0000455
Further Details:      
 
Domain Number 2 Region: 183-211
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000792
Family LIM domain 0.019
Further Details:      
 
Domain Number 3 Region: 212-242
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000855
Family LIM domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003969   Gene: ENSBTAG00000003049   Transcript: ENSBTAT00000003969
Sequence length 883
Comment pep:known_by_projection chromosome:UMD3.1:25:42015483:42035250:1 gene:ENSBTAG00000003049 transcript:ENSBTAT00000003969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAIKALQQWCRQQCEGYRDVSITDMTTSFRDGLAFCAILHRHRPDLINFDALRKENVYE
NNKLAFSVAEEQLGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFQRGASAERTAGVKR
PSSNASEEPSGKKAPTQPIQPAPGPARGQPLSPVSTNRTVQRKDGGTEGPPQKAGQAAGG
SLNSSCGVCGQHVHLMQRHLADGRLYHRGCFRCKQCSSTLHSGAYRATGEPGVFICSSHH
PETTSASPTLPSLASRRHGAMSMDSETPGGLRKTREASGQRDVGPKARLPGWDAVAGSTS
ARGSAPAATDPPAPASSRVPTGSPAAPRLMVGPAGGEAGTHVTSSSLTVWPSPAGRPRPT
GTPSAPDPCPATPQGWATPRVSAPQTKLSSRPASPVPASTPAWTPSSSKTQQARERFFQT
PGAAPGPGPAAADMPSRDGRKEQALSFLRKTLPELGAPGRAPTTATPAPSSHPRSEGPGA
SPPARASLPTSPQTLSSPARMGPPATPGVGSTSWASQEAKKGSAASSGAVGAGAGSRLKL
EAPLAKGPGASPQGSPEDQPAGWRARLKPVDKSPVDRAPEAKEPQVLREPRAGDAAGKAS
GSSKAGIRITLTSVRVDRMPGAAGPGASLPAASASASPLRKLAVPASLDVSGDWLQLEPS
RKESPARSQKEEEKGPPQGKPGRPPGPAGVAAPPAKSAASPVRLHPDDMPPEIQRQVQDI
ERQLDALELQGVGLEKRLRAAEGDDSEDALMVDWFRLVHEKQLLLRLESELMYKARDQRL
EEQQLDLEGELRRLMAKPEGLKSPQDRRREQDLLDQYVHTVNSRSDIIDFLDEDRLREQE
EDEVLQSMIQKLDLQRSSEEQRKKPRFRLSSIWSPKSRSRTPE
Download sequence
Identical sequences F6REL8
ENSBTAP00000003969 ENSBTAP00000003969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]