SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004034 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004034
Domain Number 1 Region: 775-893
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.02e-35
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004034   Gene: ENSBTAG00000003100   Transcript: ENSBTAT00000004034
Sequence length 904
Comment pep:known chromosome:UMD3.1:17:72041477:72064312:1 gene:ENSBTAG00000003100 transcript:ENSBTAT00000004034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADETLAGLDEGALRKLLEVTTDLAERRRIRSAIRELQRQELEREEEALASKRFRAERQD
NKENWLHSQQREAEQRAALARLAGRLESMNDVEELTALLRGAAEYEERKLIRAAIRRVRA
QEIEAATLAGRLYSGRPNSGSREDSKGQAARRLEPCEVPKPEEQKQQVEVPEPTPTPSSS
SRDVTTVTLLLRAPPRDTPSPPASADGSPTTTSPEPPLEPAEEALCPAPEALGSPEPPPS
PPRATSPEPQEPPATPSTDGQVVDKFPPSPTEPPAAQGPTKGRSDTKRADLADPRPCQLS
LSVLSPRQPAQNREPTPLASGPSPFQRAGSVRDRVRKFTSDSPMAAGLQECPPRAALGPS
TPARLPGPSHTSTTPAASSSSSSGPSSRGTARPLAQLQSCPREEGPRGRGLAVRSLENRA
GGPVAGSEEPSAPLPVAVGAAEPGASMKTTFTIEIKDGRGQASTGRVLLPTGNQRAELTL
GLRAPPTLISTSSGGKSTITHISSPGNLARLGSVTHVTSFSPASLGSRGGCSIKMEPEPA
EPPSAAVEVANGAEQTRVDKAPGSRSPLSAEELMAIEDESVLDKMLDQTTDFEERKLIRA
ALRELRQRKRDQRDKERERRLQEARARPGEGRGNTTTKTSTRHSQQTADGSAVSTVTKTE
RLVQSNDGTRTARTTTVESSFVRRSENGGGSTMMQTKTFSSSSSKKMGSIFDREDEASPR
SGSLAALEKRQAEKKKELMKAQSLPKTSASQARKAMIEKLEKEGAAGSPGGPRMAVQRST
SFGVPNANSIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQL
SPQNRRQNFEVAFSSAETHADCPQLLDTEDMVRLREPDWKCVYTYIQEFYRCLVQKGLVK
TKKS
Download sequence
Identical sequences Q08DZ4
NP_001070347.1.59421 NP_001070347.1.76553 ENSBTAP00000004034 ENSBTAP00000054121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]